PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn213191
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LFY
Protein Properties Length: 414aa    MW: 45905.4 Da    PI: 7.2616
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn213191genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY628.88.7e-192353991386
     FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrl 99 
                 mdp+afsaslfkwdpr  +a +p +l e a+++++p         r+l +le++f+ayGvry+t+akiaelGftv+tL+dmk+eel+d+m+sls+ifr+
  Achn213191  35 MDPDAFSASLFKWDPRGPVAVAP-HL-EAAHAVRPP---------RELGGLEDFFQAYGVRYYTAAKIAELGFTVNTLLDMKEEELEDMMNSLSQIFRW 122
                 9**************97664444.22.333333444.........6799************************************************** PP

     FLO_LFY 100 dllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekkseeekkkaskkkqkrkkk 198
                 dllvGeryGikaavraerrrl+eee  ++rr+lls+d+++aldalsqeglsee+vq+++ a + gg+g g +e+va+       +kk++    +++k +
  Achn213191 123 DLLVGERYGIKAAVRAERRRLDEEE--ARRRHLLSADTANALDALSQEGLSEERVQQKEAAGSGGGAGGGGWEVVAVGG----GSKKQQ----RRKKVQ 211
                 ***********************87..99999**********************9885555555666778999999983....223333....333444 PP

     FLO_LFY 199 kelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyi 297
                  +++s +d+d+ ++  +d++++g +g++rqrehPfivtepgevargkknGLDYLf+LyeqCrefL+qvq++akerGekcPtkvtnqvfryakkagasyi
  Achn213191 212 ARMASFDDDDDVSDGGDDDDNGGGRGDHRQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLIQVQSVAKERGEKCPTKVTNQVFRYAKKAGASYI 310
                 4445556777777777888888888************************************************************************** PP

     FLO_LFY 298 nkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                 nkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawr+acy+plvaiaarqgwdid++fnahprL++WYvPtkLrqLCh+e+s+a+
  Achn213191 311 NKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGAWRHACYNPLVAIAARQGWDIDSIFNAHPRLAVWYVPTKLRQLCHAEHSSAA 399
                 ************************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016983.3E-19635398IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MDAKRRLRSG LPSLHVPHNS STAQSGIGSD ILRDMDPDAF SASLFKWDPR GPVAVAPHLE  60
AAHAVRPPRE LGGLEDFFQA YGVRYYTAAK IAELGFTVNT LLDMKEEELE DMMNSLSQIF  120
RWDLLVGERY GIKAAVRAER RRLDEEEARR RHLLSADTAN ALDALSQEGL SEERVQQKEA  180
AGSGGGAGGG GWEVVAVGGG SKKQQRRKKV QARMASFDDD DDVSDGGDDD DNGGGRGDHR  240
QREHPFIVTE PGEVARGKKN GLDYLFHLYE QCREFLIQVQ SVAKERGEKC PTKVTNQVFR  300
YAKKAGASYI NKPKMRHYVH CYALHCLDEE ASNALRRAFK ERGENVGAWR HACYNPLVAI  360
AARQGWDIDS IFNAHPRLAV WYVPTKLRQL CHAEHSSAAT PTSVSSGPEH LPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1062373972162PROTEIN LEAFY
2vy2_A1e-1062373972162PROTEIN LEAFY
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1816631e-122AF181663.1 Actinidia deliciosa leafy/floricaula homolog mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002284664.10.0PREDICTED: floricaula/leafy homolog
SwissprotO485590.0UNI_PEA; Protein UNIFOLIATA
TrEMBLQ6GVJ60.0Q6GVJ6_9R
STRINGVIT_17s0000g00150.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA66682333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-105floral meristem identity control protein LEAFY (LFY)